ZNF83 anticorps (N-Term)

N° du produit ABIN1449869

L’anticorps Lapin Polyclonal anti-ZNF83 a été validé pour WB. Il convient pour détecter ZNF83 dans des échantillons de Humain.

Aperçu rapide pour ZNF83 anticorps (N-Term) (ABIN1449869)

Antigène: ZNF83 (Zinc Finger Protein 83 (ZNF83))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZNF83 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ZNF83 anticorps

Épitope: N-Term

Séquence: MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSS

Réactivité croisée (Details): Species reactivity (tested):Human

Purification: Peptide immunoaffinity column

Immunogène: A synthetic peptide directed towards the N-terminal region of human ZNF8

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Reconstitution: Add 50 μL of distilled water to a final concentration of 1.0 mg/mL.

Concentration: 1.0 mg/mL after reconstitution

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or (in aliquots) at -20 °C long term.

Détails sur ZNF83

Antigène: ZNF83 (Zinc Finger Protein 83 (ZNF83))

Autre désignation: ZNF83

Sujet: ZNF83 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 15 C2H2-type zinc fingers. ZNF83 may be involved in transcriptional regulation.Synonyms: HPF1, ZNF816B, Zinc finger protein 816B, Zinc finger protein 83, Zinc finger protein HPF1

Poids moléculaire: 60 kDa (516 aa)

ID gène: 55769

NCBI Accession: NP_001099019